PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1BL_A75EDBFD9.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family FAR1
Protein Properties Length: 127aa    MW: 14403.6 Da    PI: 10.6199
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1BL_A75EDBFD9.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR131.94.5e-1013525190
                   FAR1 51 errtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90
                            r+++ ++r+gC+a++++ +++d+ w++++ +  HnH+++
  Traes_1BL_A75EDBFD9.2 13 IRENSRSSRCGCNAMIRLLRSNDKGWYIAEHKDAHNHPMS 52
                           578889*******************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031014.1E-71452IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 127 aa     Download sequence    Send to blast
MQEIVCACAG KPIRENSRSS RCGCNAMIRL LRSNDKGWYI AEHKDAHNHP MSLTCGQKLH  60
WKSHRHIDRY TKDLVKQLRD NNVGLGKVFS IVGSFFGSVD NVPFTKRSLK TLCRKLNRVS  120
STTSSVQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703061e-167HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014753620.18e-64PREDICTED: putative protein FAR1-RELATED SEQUENCE 10
TrEMBLW5A4U77e-92W5A4U7_WHEAT; Uncharacterized protein
STRINGBRADI1G32950.11e-63(Brachypodium distachyon)
STRINGBRADI2G07910.12e-62(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP6191991
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]